Analytical Data
-
Gene name
CENPE
- Application
-
Alternative Names
CENPE；Centromere-associated Protein E
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q02224
-
Expression Region
309-419aa
-
AA Sequence
TPVSFDETLTALQFASTAKYMKNTPYVNEVSTDEALLKRYRKEIMDLKKQ LEEVSLETRAQAMEKDQLAQLLEEKDLLQKVQNEKIENLTRMLVTSSSLT LQQELKAKRKR
-
Molecular Weight
316 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CENPE (Centromere Protein E) is a key player in the regulation of mitosis, specifically in the proper alignment and segregation of chromosomes during cell division. Recent studies have highlighted its vital role in the process of chromosome congression, where it acts as a motor protein that facilitates the movement of chromosomes towards the metaphase plate. Dysregulation or mutations in CENPE have been associated with various cancers, underscoring its potential as a therapeutic target. The production and study of recombinant CENPE proteins have become essential for elucidating its structure-function relationships and for developing inhibitors that could interfere with its function in cancer cells. By generating recombinant CENPE in suitable expression systems, researchers can explore its biophysical properties, interactions with other centromere components, and its enzymatic activities. This investigation not only contributes to our understanding of chromosomal dynamics but also opens avenues for targeted cancer therapies. The continuous exploration of CENPE's molecular mechanisms is anticipated to yield innovative strategies for cancer treatment, aiming at enhancing the specificity and efficacy of therapeutic interventions.
