Analytical Data
-
Gene name
MBL2
- Application
-
Alternative Names
MBL2;COLEC1;MBL;Mannose-binding Protein C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11226
-
Expression Region
21-248aa
-
AA Sequence
ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQ GPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMA RIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAE NGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDE DCVLLLKNGQWNDVPCSTSHLAVCEFPIVDHHHHHH
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MBL2 (Mannose-Binding Lectin 2) is a crucial component of the innate immune system, involved in pathogen recognition and activation of the complement pathway. Research into MBL2 has gained momentum due to its significance in various immune responses and its association with several diseases, including infections, autoimmune disorders, and metabolic syndromes. Higher levels of MBL2 are often linked to enhanced immunity against specific pathogens, while polymorphisms in the MBL2 gene can lead to varying concentrations of the protein, influencing an individual's susceptibility to infections. Studies have indicated that individuals with certain MBL2 variants exhibit a higher risk of severe infections and may also have altered responses to vaccines. Furthermore, MBL2’s role in immune modulation highlights its potential as a therapeutic target. By investigating the structure, function, and genetic variations of MBL2, researchers aim to understand its contributions to both host defense and disease pathology. This foundational research could pave the way for novel diagnostic tools and therapeutic strategies that harness the power of MBL2 in enhancing immune responses or mitigating disease progression, making it a significant focus in immunology and translational medicine.











