Cat: PA1000-2032

Recombinant Human MSTN Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MSTN

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MSTN;GDF8;Growth/differentiation factor 8

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O14793

  • Expression Region

    24-375aa

  • AA Sequence

    HHHHHHASNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLR LETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATT ETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVET PTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNW LKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSR RDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEF VFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIP AMVVDRCGCS

  • Molecular Weight

    71 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MSTN, or myostatin, is a member of the transforming growth factor-beta (TGF-β) superfamily and plays a significant role in regulating skeletal muscle growth and development. It is primarily known for its function as a negative regulator of muscle mass, meaning that it inhibits muscle differentiation and proliferation. Elevated levels of myostatin are associated with muscle wasting conditions, such as cachexia, muscular dystrophy, and age-related sarcopenia, raising interest in its potential as a therapeutic target. The use of recombinant MSTN proteins in research allows scientists to better understand its molecular mechanisms and interactions in muscle biology. By studying the effects of MSTN on muscle cells, researchers aim to identify strategies for counteracting muscle loss and promoting muscle regeneration. In this context, recombinant myostatin proteins are also investigated for their potential in developing treatments for muscle-related disorders and enhancing muscle growth in livestock for agricultural purposes. As a result, the development and characterization of MSTN recombinant proteins play a pivotal role in advancing our understanding of muscle regulation and the potential for innovative therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US