Analytical Data
-
Gene name
PAF
- Application
-
Alternative Names
PAF；Platelet-activating factor acetylhydrolase 2. cytoplasmic
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99487
-
Expression Region
1-392aa
-
AA Sequence
MGVNQSVGFPPVTGPHLVGCGDVMEGQNLQGSFFRLFYPCQKAEETMEQPLWIPRYEYCTGLAEYLQFNKRCGGLLFNLAVGSCRLPVSWNGPFKTKDSGYPLIIFSHGLGAFRTLYSAFCMELASRGFVVAVPEHRDRSAATTYFCKQAPEENQPTNESLQEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPVFFINTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL
-
Molecular Weight
44 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PAF (Platelet-Activating Factor) is a potent phospholipid mediator involved in various physiological and pathological processes, including inflammation, thrombosis, and immune responses. Its biological activity is primarily regulated through its interaction with specific receptors and the enzymatic activity of phospholipase A2, which catalyzes the release of PAF from membrane phospholipids. The interest in recombinant PAF proteins has surged in recent years due to their potential applications in drug development, diagnostic tools, and therapeutic agents targeting related diseases. Researchers have focused on elucidating the structure and function of PAF and its receptors to uncover the molecular mechanisms underlying its role in health and disease. Additionally, recombinant techniques allow for the production of modified PAF or PAF receptor proteins, facilitating studies on their signaling pathways and interactions with other biomolecules. These advances provide insights into PAF's role in disease states like asthma, sepsis, and cardiovascular disorders. By harnessing recombinant technology, scientists aim to develop novel therapeutics that can modulate PAF activity, offering new avenues for treating inflammatory and immune-related conditions. The exploration of PAF-related recombinant proteins continues to expand our understanding of this critical lipid mediator and its potential clinical implications.
