Analytical Data
-
Gene name
LMO2
- Application
-
Alternative Names
Cysteine rich protein TTG 2; Cysteine rich protein TTG2; Cysteine-rich protein TTG-2; LIM domain only 2 (rhombotin like 1); LIM domain only 2; LIM domain only protein 2; LMO 2; LMO-2; lmo2; RBTN 2; RBTN L1; RBTN2; RBTN2_HUMAN; RBTNL 1; RBTNL1; RHOM 2; RHOM2; Rhombotin 2; Rhombotin like 1; Rhombotin-2; Rhombotin2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P25791
-
Expression Region
1-158aa
-
AA Sequence
MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRPFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI
-
Molecular Weight
43.12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LMO2 (LIM domain only 2) is a protein that plays a crucial role in hematopoiesis and lymphocyte development. It belongs to the LIM domain protein family, which are characterized by zinc-binding motifs that facilitate protein-protein interactions. Abnormal expression of LMO2 is associated with various hematological malignancies, particularly T-cell acute lymphoblastic leukemia (T-ALL) and certain lymphomas. This has led to an increased interest in understanding its function and regulation at the molecular level. Research on LMO2 often focuses on its role as a transcriptional regulator, where it interacts with other proteins like TAL1 and E2A to influence gene expression patterns crucial for normal cell differentiation and proliferation. The study of LMO2 also extends to its potential as a therapeutic target; thus, recombinant LMO2 proteins are engineered for functional assays, further elucidating its involvement in cancer and immune responses. Additionally, the production of LMO2 as a recombinant protein in various expression systems facilitates the examination of its structure and interactions, providing insights that could lead to novel therapeutic strategies for diseases linked to its dysregulation. Overall, LMO2 serves as a significant model for investigating the complexities of gene regulatory networks in hematopoiesis and is a focal point in the development of targeted interventions for leukemia and related disorders.
