Analytical Data
-
Gene name
Nrg
- Application
-
Alternative Names
Nrg；Pro-neuregulin-4. membrane-bound isoform
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20241
-
Expression Region
610-814aa
-
AA Sequence
IVQDVPNAPKLTGITCQADKAEIHWEQQGDNRSPILHYTIQFNTSFTPASWDAAYEKVPNTDSSFVVQMSPWANYTFRVIAFNKIGASPPSAHSDSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEIEHNAPNFHYYVSWKRDIPAAAWENNNIFDWRQNNIVIADQPTFVKYLIKVVAINDRGESNVAAEEVVGYSGEDR
-
Molecular Weight
28.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research into Nrg (neuregulin) recombinant proteins has gained significant traction within the fields of neurobiology and cancer research due to its crucial role in cellular signaling processes. Neuregulins are a family of growth factors that interact with the ErbB receptor tyrosine kinase family and are vital for various physiological functions, including neural development, cardiogenesis, and the modulation of synaptic activity. Aberrant Nrg signaling has been implicated in several pathological conditions, such as schizophrenia, breast cancer, and heart failure. The production of recombinant Nrg proteins allows researchers to investigate their specific functions, therapeutic potentials, and signaling mechanisms in various cellular contexts. By utilizing methods such as genetic engineering and recombinant DNA technology, scientists are able to produce these proteins in sufficient quantities for detailed studies. This exploration not only enhances our understanding of neuregulin's role in development and disease but also aids in the identification of potential therapeutic targets and strategies. Overall, the study of recombinant Nrg proteins stands at the intersection of fundamental biology and clinical applications, paving the way for innovative approaches to treat conditions associated with Nrg dysregulation.
