Analytical Data
-
Gene name
LOC619207
- Application
-
Alternative Names
Scavenger receptor cysteine-rich domain-containing protein SCART1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q4G0T1
-
Expression Region
1-232aa
-
AA Sequence
MRAALWTLGLGPLLLNLWAVPIGGPGALRLAYRHSTCDGVVLVRHHGAWGYVCNQEWTLAEASVVCRQLGCGPAVGAPKYVPLPGEMAKPWLHNVSCRGNESSLWECSLGSWCQSPCPHAWVVVALCSNGTFRELGLVKGRSPCAGLPEIRNVNGVDRLCVLHVEEAMVFCRELGCGPVLQAPRRDVGVVRKYLACRGTEPTIRSCRLDNNFRSGCDLRLDAEVVCSGEAAT
-
Molecular Weight
51.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LOC619207 is a gene that has garnered attention due to its potential role in various biological processes and its implications in health and disease. Researchers have identified LOC619207 as a candidate for further investigation because it may be involved in essential cellular functions, including regulation of gene expression and protein synthesis. The study of LOC619207's recombinant protein is particularly significant as it could provide insights into its molecular mechanisms and interactions within cellular pathways. Given the increasing incidence of diseases linked to gene dysregulation, understanding LOC619207's function could pave the way for novel therapeutic approaches. Additionally, recombinant proteins derived from LOC619207 may have utility in diagnostic applications, acting as biomarkers for specific conditions. The background research underscores the importance of developing methods for the efficient expression and purification of this protein, facilitating its functional characterization and potential application in biomedicine. Overall, the exploration of LOC619207 and its recombinant protein is a promising avenue for advancing our understanding of genetic regulation and discovering innovative solutions for treating related diseases.
