Analytical Data
-
Gene name
LPAR4
- Application
-
Alternative Names
LPAR4; GPR23; LPA4; P2RY9; Lysophosphatidic acid receptor 4; LPA receptor 4; LPA-4; G-protein coupled receptor 23; P2Y purinoceptor 9; P2Y9; P2Y5-like receptor; Purinergic receptor 9
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99677
-
Expression Region
1-370aa
-
AA Sequence
MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVSLFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLTNIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLATLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF
-
Molecular Weight
41.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LPAR4 (lysophosphatidic acid receptor 4) is a member of the lysophosphatidic acid receptor family, which plays a pivotal role in various physiological and pathological processes, including cell proliferation, migration, and survival. Research into LPAR4 has gained significant attention due to its potential implications in cancer biology, as aberrant signaling through this receptor has been implicated in tumorigenesis and metastasis. Additionally, LPAR4 is involved in other conditions such as fibrosis, neuropathic pain, and cardiovascular diseases. Understanding the molecular mechanisms underlying LPAR4 signaling is crucial for the development of targeted therapies. The recombinant expression of LPAR4 protein allows for detailed investigation of its structure-function relationship and interaction with ligands. This research not only sheds light on the receptor's biological functions but could also facilitate the design of specific inhibitors or modulators that could be used for therapeutic purposes. The study of LPAR4 and its associated pathways holds promise for advancing our understanding of various diseases and developing innovative treatments.
