Analytical Data
-
Gene name
NFNB
- Application
-
Alternative Names
nfnB;Nitroreductase NfnB
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P38489
-
Expression Region
1-217aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMDIISVALKRHSTKAFDASKKLTPEQAEQI KTLLQYSPSSTNSQPWHFIVASTEEGKARVAKSAAGNYVFNERKMLDASH VVVFCAKTAMDDVWLKLVVDQEDADGRFATPEAKAANDKGRKFFADMHRK DLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVPIEGFDAAILDAEFGLKE KGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITLTEV
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The NFNB protein, also known as Nuclear Factor kappa B (NF-κB), plays a critical role in regulating immune responses, inflammation, and cell survival. Research on NF-κB has gained momentum due to its involvement in various diseases, including cancer, autoimmune disorders, and chronic inflammatory conditions. As a transcription factor, NF-κB is typically sequestered in the cytoplasm in an inactive form bound to inhibitors. Upon activation by various stimuli, such as cytokines or stress signals, NF-κB is released and translocates to the nucleus, where it binds to specific DNA sequences to initiate gene expression. Despite significant advances in understanding its biological functions, the complexity of NF-κB signaling pathways presents challenges in therapeutic interventions. Researchers have been focusing on recombinant techniques to produce NF-κB proteins, which can facilitate detailed studies of its structure and function. These efforts have led to insights into the molecular mechanisms governing NF-κB activity and interactions with other signaling pathways, paving the way for potential novel therapeutic strategies aimed at modulating NF-κB activity. The development of NF-κB recombinant proteins not only enhances our comprehension of physiological processes but also contributes to the exploration of targeted therapies for diseases where NF-κB dysregulation is a key factor. Thus, the study of NF-κB recombinant proteins is a promising field with significant implications for biomedical research and therapeutic applications.











