Analytical Data
-
Gene name
NME1
- Application
-
Alternative Names
GRIN2A;NMDAR2A;Glutamate receptor ionotropic. NMDA 2A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15531
-
Expression Region
2-152aa
-
AA Sequence
ANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
-
Molecular Weight
44.0kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NME1, also known as non-metastatic cells 1, is a gene initially identified for its role in inhibiting cancer metastasis. Recent research has shown that NME1 is a member of a family of nucleoside diphosphate kinases involved in the regulation of cellular processes, such as cell proliferation and differentiation. Understanding NME1's functions is crucial, as it has been implicated in various pathological conditions, including cancer progression, neurodegenerative diseases, and inflammatory responses. Recombining and characterizing NME1 protein facilitates the investigation of its biochemical properties and potential interactions with other cellular components. Researchers aim to elucidate the molecular mechanisms underlying NME1’s diverse roles in human health and disease, paving the way for potential therapeutic applications. Given its significance in tumor biology and cellular regulation, the recombinant expression of NME1 in different systems enables the study of its enzymatic activity and interaction dynamics, contributing to a comprehensive understanding of its biological functions. As such, NME1 represents a promising target for further research, potentially leading to novel strategies in cancer treatment and regenerative medicine.
