Analytical Data
-
Gene name
LRRC57
- Application
-
Alternative Names
AA407405; DKFZp686H1865; FLJ36812; Leucine rich repeat containing 57; Leucine rich repeat containing protein 57; Leucine-rich repeat-containing protein 57; LRC57_HUMAN; lrrc57; MGC109337
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N9N7
-
Expression Region
1-239aa
-
AA Sequence
MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKIESLPPLLIGKFTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCSLRHLDVMDLSKNQIRSIPDSVGELQVIELNLNQNQISQISVKISCCPRLKILRLEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDKYMERFTATKKNFA
-
Molecular Weight
53.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LRRC57 (Leucine-Rich Repeat Containing 57) is a protein that has garnered attention in recent years due to its potential roles in various biological processes, particularly in the immune response and cell signaling mechanisms. Research into LRRC57 has revealed its involvement in the regulation of inflammatory pathways, which are crucial for maintaining immune homeostasis. Dysregulation of these pathways is often linked to autoimmune diseases and chronic inflammatory conditions. The study of LRRC57 as a recombinant protein allows for a deeper understanding of its functional properties and interactions with other cellular components. Through expression systems designed to produce this protein in significant quantities, scientists aim to elucidate its structural characteristics, binding partners, and the specific pathways it modulates. Moreover, investigating the therapeutic potential of LRRC57 may provide insight into novel treatment strategies for immunological disorders. As such, ongoing studies focus on characterizing the protein's functional domains, its expression patterns in various tissues, and its potential as a biomarker for disease states, underscoring the significance of LRRC57 in both basic research and clinical applications.
