Analytical Data
-
Gene name
LRRC56
- Application
-
Alternative Names
Leucine-rich repeat-containing protein 56; LRC56_HUMAN; Lrrc56
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IYG6
-
Expression Region
1-542aa
-
AA Sequence
MDLGWDRSRGPRRSTSSVRVRELSWQGLHNPCPQSKGPGSQRDRLGEQLVEEYLSPARLQALARVDDLRLVRTLEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWLARCGLADLDGIASLPALKELYASYNNISDLSPLCLLEQLEVLDLEGNSVEDLGQVRYLQLCPRLAMLTLEGNLVCLQPAPGPTNKVPRGYNYRAEVRKLIPQLQVLDEVPAAHTGPPAPPRLSQDWLAVKEAIKKGNGLPPLDCPRGAPIRRLDPELSLPETQSRASRPWPFSLLVRGGPLPEGLLSEDLAPEDNTSSLTHGAGQVLCGNPTKGLRERRHQCQAREPPEQLPQHRPGDPAASTSTPEPDPADSSDFLALAGLRAWREHGVRPLPYRHPESQQEGAVAPWGPRRVPEEQVHQAEPKTPSSPPSLASEPSGTSSQHLVPSPPKHPRPRDSGSSSPRWSTDLQSRGRRLRVLGSWGPGLGDGVAAVPVLRALEVASRLSPRAQGCPGPKPAPDAAARPPRAAELSHPSPVPT
-
Molecular Weight
85.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LRRC56 (Leucine-Rich Repeat Containing Protein 56) is a protein that has gained attention in recent years due to its potential role in various biological processes, including cell signaling, development, and immune response. Research indicates that LRRC56 is highly expressed in specific tissues, suggesting its involvement in localized cellular functions and possibly in pathological conditions. Understanding the structure and function of LRRC56 is crucial, as it may play a role in diseases such as cancer and neurodegenerative disorders. The recombinant protein of LRRC56 provides a valuable tool for studying its biochemical properties and interactions with other cellular components. By producing LRRC56 in a controlled laboratory environment, researchers can investigate its functional role, explore its potential as a biomarker, and assess its utility in therapeutic applications. Moreover, dissecting the signaling pathways that involve LRRC56 can unravel its contributions to cellular homeostasis and disease progression. The ongoing research on LRRC56 recombinant proteins aims not only to clarify its specific biological roles but also to elucidate how modulation of its activity might offer novel strategies for disease intervention. As such, LRRC56 represents a promising focus within the realms of molecular biology and medical research, with implications for understanding complex biological networks and developing innovative therapeutic approaches.
