Analytical Data
-
Gene name
Krtdap
- Application
-
Alternative Names
Krtdap；KDAP；Keratinocyte differentiation-associated Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P60985
-
Expression Region
1-99aa
-
AA Sequence
MKIPVLPAVVLLSLLVLHSAQGATLGGPEEESTIENYASRPEAFNTPFLNIDKLRSAFKADEFLNWHALFESIKRKLPFLNWDAFPKLKGLRSATPDAQ
-
Molecular Weight
11.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Krtdap, or Keratinocyte Differentiation-Associated Protein, is a novel protein that has garnered attention in the field of skin biology and dermatological research. It is primarily expressed in keratinocytes, the predominant cell type in the epidermis, and plays a crucial role in the regulation of skin differentiation and barrier function. Recent studies have indicated that Krtdap is involved in maintaining epidermal integrity and promoting wound healing, making it a potential target for therapeutic interventions in skin disorders such as psoriasis, atopic dermatitis, and wound healing deficiencies. Additionally, the characterization and functional analysis of Krtdap could provide insights into the molecular mechanisms underlying keratinocyte behavior during various physiological and pathological conditions. Research involving the recombinant expression of Krtdap serves to elucidate its structural and functional properties, and how these may influence cellular processes within the skin. Understanding the specific roles of Krtdap could pave the way for developing novel skin-care products and strategies for enhancing skin health, ultimately contributing to improved clinical outcomes for patients suffering from skin-related ailments. The continued investigation into Krtdap’s function emphasizes the importance of keratinocyte biology in dermatological health and disease, highlighting a promising avenue for future studies aimed at targeting this protein for therapeutic benefits in skincare and regenerative medicine.
