Analytical Data
-
Gene name
odh1
- Application
-
Alternative Names
odh1；Olfactory receptor 13H1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BHM6
-
Expression Region
1-399aa
-
AA Sequence
MTVKVCVCGGGNGAHTLSGLAASRDGVEVRVLTLFADEAERWTKALGADELTVIVNEKDGTQTEVKSRPKVITKDPEIAISGADVVILTVPAFAHEGYFQAMAPYVQDSALIVGLPSQAGFEFQCRDILGDKAAAVSMMSFETLPWACRIKEFGRKVEVLGTKSVLAASLIKGTAKTVDPLSTLQMLHGAEPVFRLAKHFLEMLIMSYSFVHPAILFGRWGSWDGKPVPEAPLFYQGIDQATADMLTACSNECKDVANAIMAACPGNDLSDVKDIYQWYLEYYHEDIQDDHDLYHAITTNKSYKGLVHPVKAVDGGVAPDFGNRYLTEDIPMGMIVFKGVAIAAGVAIPSNDKLIMWAQEKIGKEYLVDGALTGKDVATTRCPQRYGFNTLDAILTGKK
-
Molecular Weight
50.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of ODH1 recombinant protein has gained significant attention in the field of molecular biology and biotechnology due to its potential applications in therapeutic and industrial processes. ODH1, or oxoglutarate dehydrogenase 1, is an essential enzyme involved in cellular metabolism, specifically in the conversion of alpha-ketoglutarate to succinyl-CoA in the Krebs cycle. Its significance lies in its role in energy production and the regulation of metabolic pathways, which are crucial for various physiological processes. Additionally, the dysfunction of ODH1 has been linked to metabolic disorders and certain diseases, making it a target for research aimed at understanding its biological function and developing novel treatment strategies. The recombinant production of ODH1 allows for detailed characterization of its properties, including enzymatic activity, structure, and interactions with substrates and inhibitors. Furthermore, advances in recombinant DNA technology enable the expression of ODH1 in model organisms, facilitating the study of its mechanisms and potential therapeutic applications, such as enzyme replacement therapy or drug development. Overall, the research on ODH1 recombinant protein not only enhances our understanding of fundamental metabolic processes but also paves the way for innovative approaches in medicine and biotechnology.
