Analytical Data
-
Gene name
int
- Application
-
Alternative Names
int；INT1；Proto-oncogene Wnt-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P04426
-
Expression Region
28-370aa
-
AA Sequence
ANSSGRWWGIVNIASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL
-
Molecular Weight
45.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Int proteins, or integration host factors, are pivotal in the study of molecular biology and genetic engineering, particularly concerning their role in the integration of viral DNA into host genomes. These proteins facilitate the integration process by recognizing and binding to specific DNA sequences, thus influencing gene expression and the stability of the integrated DNA. The research surrounding Int proteins has implications for understanding viral replication, pathogenesis, and the development of gene therapies. Their ability to mediate genetic recombination has garnered interest in leveraging these proteins for novel biotechnological applications, including the creation of genetically modified organisms and targeted gene therapies. With advancements in genome editing technologies, such as CRISPR-Cas9, understanding the mechanisms and functions of Int proteins can lead to improved strategies for precise genetic modifications. Additionally, the exploration of Int proteins extends to their potential role in synthetic biology, where they can be engineered for specific tasks, such as the targeted delivery of therapeutic genes. Given the rising need for innovative treatments and the quest for deeper insights into gene regulation mechanisms, ongoing research into Int proteins remains a critical area of focus, promising to enhance both our basic scientific knowledge and practical applications in medicine and agriculture.
