Cat: PA1000-2190

Recombinant Human NRGN Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NRGN

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NRGN;Neurogranin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q92686

  • Expression Region

    1-78aa

  • AA Sequence

    MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGE RGRKGPGPGGPGGAGVARGGAGGGPSGD

  • Molecular Weight

    35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NRGN (Neurogranin) is a prominent protein predominantly expressed in the brain, particularly in the postsynaptic terminals of neurons. It plays a critical role in synaptic plasticity and cognitive processes, including learning and memory. The study of NRGN recombinant proteins has gained importance due to their potential implications in neurodegenerative diseases and cognitive disorders. Researchers are particularly interested in how alterations in NRGN expression and function may contribute to conditions such as Alzheimer's disease and schizophrenia. Recombinant NRGN proteins are being developed to better elucidate their biological functions and interactions within the synaptic environment, thereby enhancing our understanding of neuronal signaling pathways. Furthermore, these studies aim to identify potential therapeutic targets, as modulating NRGN levels could pave the way for novel treatment strategies aimed at improving cognitive function in affected individuals. Continued exploration of NRGN recombinant protein applications may lead to breakthroughs in the development of biomarkers for early diagnosis and advanced treatments for neuropsychiatric conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US