Analytical Data
-
Gene name
FITC
- Application
-
Alternative Names
FITC；Ribosomal processing cysteine protease Prp
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q2FXS9
-
Expression Region
1-106aa
-
AA Sequence
MITVDITVNDEGKVTDVIMDGHADHGEYGHDIVCAGASAVLFGSVNAIIGLTSERPDINYDDNGGHFHIRSVDTNNDEAQLILQTMLVSLQTIEEEYNENIRLNYK
-
Molecular Weight
11.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FITC (Fluorescein Isothiocyanate) recombinant proteins have garnered significant attention in the field of molecular biology and biochemistry due to their unique fluorescent properties, which enable sensitive detection and visualization of proteins in biological samples. The use of FITC in fluorescent labeling allows researchers to track protein localization, interactions, and dynamics in live cells, thereby providing valuable insights into cellular processes. Recombinant DNA technology has facilitated the production of FITC-conjugated proteins, allowing for standardized protocols and reducing variability in experimental outcomes. The ability to specifically tag proteins using FITC has enhanced the study of protein expression, folding, and post-translational modifications. Moreover, the broad application of FITC-labeled antibodies in immunofluorescence has revolutionized techniques such as flow cytometry and confocal microscopy, making them indispensable tools in both basic research and clinical diagnostics. As the demand for precise and reliable protein assays continues to grow, ongoing research in optimizing FITC conjugation methods and improving its brightness and photostability promises to advance our understanding of biological systems, disease mechanisms, and the development of therapeutic strategies.
