Analytical Data
-
Gene name
LSM2
- Application
-
Alternative Names
LSM2. C6orf28. G7B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y333
-
Expression Region
1-95aa
-
AA Sequence
MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
-
Molecular Weight
36.85 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The LSM2 protein, part of the Lsm (Like Sm) protein family, plays a crucial role in RNA metabolism, particularly in RNA splicing and degradation processes. Research into LSM2 began due to its involvement in the assembly of the spliceosomal complex, which is vital for pre-mRNA processing. Additionally, LSM2 contributes to the regulation of mRNA stability and the cellular response to various stress conditions. Given its functional significance, studies have indicated that LSM2 interacts with other Lsm proteins, forming multi-protein complexes that are essential for efficient RNA turnover. Dysregulation of LSM2 has been linked to several diseases, including certain types of cancer, making it a potential biomarker and therapeutic target. Understanding LSM2's specific molecular mechanisms and interactions within the cell can provide insights into broader RNA biology and its implications in health and disease. Researchers are employing various techniques, including structural biology and functional assays, to elucidate the precise roles of LSM2 and its potential impact on gene expression regulation. Thus, ongoing studies aim to define the importance of LSM2 in cellular processes and how its dysfunction contributes to pathological states, facilitating the development of novel strategies for intervention in RNA-related diseases.
