Cat: PA2000-4914

Recombinant Human narG Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    narG

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    narG;BRCC1;NARG2;Little elongation complex subunit 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P09152

  • Expression Region

    1-110aa

  • AA Sequence

    MSKFLDRFRYFKQKGETFADGHGQLLNTNRDWEDGYRQRWQHDKIVRSTHGVNCTGSCSWKIYVKNGLVTWETQQTDYPRTRPDLPNHEPRGCPRGASYSWYLYSANRLK

  • Molecular Weight

    20.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of narG recombinant protein is significant due to its role in the nitrite reduction process within bacteria, particularly in Escherichia coli and other nitrifying organisms. narG encodes the alpha subunit of the nitrate reductase enzyme, which catalyzes the reduction of nitrate to nitrite, an essential step in the nitrogen cycle. Understanding the function and structure of NarG is crucial for elucidating the biochemical pathways involved in nitrogen metabolism, which have direct implications for environmental management, agriculture, and biotechnology. The characterization of narG and its recombinant protein offers insights into enzyme efficiency, stability, and regulation under varying environmental conditions. Moreover, research on narG can lead to advancements in bioremediation techniques, where engineered microorganisms could be employed to improve the removal of pollutants like nitrate from wastewater. Additionally, the potential for recombinant narG proteins to be used in biosensors or as biocatalysts in industrial processes highlights their economic significance. Overall, the investigation of narG recombinant proteins represents an interdisciplinary approach to solving ecological and industrial challenges related to nitrogen compounds, thus underscoring the importance of this research in the context of sustainable practices and innovation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US