Analytical Data
-
Gene name
narG
- Application
-
Alternative Names
narG;BRCC1;NARG2;Little elongation complex subunit 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09152
-
Expression Region
1-110aa
-
AA Sequence
MSKFLDRFRYFKQKGETFADGHGQLLNTNRDWEDGYRQRWQHDKIVRSTHGVNCTGSCSWKIYVKNGLVTWETQQTDYPRTRPDLPNHEPRGCPRGASYSWYLYSANRLK
-
Molecular Weight
20.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of narG recombinant protein is significant due to its role in the nitrite reduction process within bacteria, particularly in Escherichia coli and other nitrifying organisms. narG encodes the alpha subunit of the nitrate reductase enzyme, which catalyzes the reduction of nitrate to nitrite, an essential step in the nitrogen cycle. Understanding the function and structure of NarG is crucial for elucidating the biochemical pathways involved in nitrogen metabolism, which have direct implications for environmental management, agriculture, and biotechnology. The characterization of narG and its recombinant protein offers insights into enzyme efficiency, stability, and regulation under varying environmental conditions. Moreover, research on narG can lead to advancements in bioremediation techniques, where engineered microorganisms could be employed to improve the removal of pollutants like nitrate from wastewater. Additionally, the potential for recombinant narG proteins to be used in biosensors or as biocatalysts in industrial processes highlights their economic significance. Overall, the investigation of narG recombinant proteins represents an interdisciplinary approach to solving ecological and industrial challenges related to nitrogen compounds, thus underscoring the importance of this research in the context of sustainable practices and innovation.











