Analytical Data
-
Gene name
Mgat3
- Application
-
Alternative Names
Mgat3;GGNT3;Beta-1.4-mannosyl-glycoProtein 4-beta-N-acetylglucosaminyltransferase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86VF5
-
Expression Region
1-341aa
-
AA Sequence
MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFTSLWPFSVFYLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMCTGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQPQLGQAVVIMVGGAHEALYSVPGEHCLTLQKRKGFVRLALRHGASLVPVYSFGENDIFRLKAFATGSWQHWCQLTFKKLMGFSPCIFWGRGLFSATSWGLLPFAVPITTVVGRPIPVPQRLHPTEEEVNHYHALYMTALEQLFEEHKESCGVPASTCLTFI
-
Molecular Weight
38.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Mgat3, or Mannosyl-Glycoprotein N-Acetylglucosaminyltransferase 3, is an essential enzyme in the glycosylation pathway, specifically involved in the modification of glycoproteins. Its primary function is to transfer N-acetylglucosamine (GlcNAc) to mannose residues on glycoproteins, thereby influencing their structural and functional properties. The significance of Mgat3 lies not only in its role in the synthesis of complex N-glycans but also in its association with various biological processes, including cell signaling, immune responses, and tumor progression. Dysregulation of Mgat3 has been implicated in several diseases, including cancer and genetic disorders, highlighting the enzyme's potential as a therapeutic target. Research on the recombinant production of Mgat3 protein allows for a deeper understanding of its enzymatic mechanism and substrate specificity, which could pave the way for novel strategies in glycoengineering and the development of glycoprotein-based therapeutics. Studies utilizing recombinant Mgat3 can also elucidate how variations in glycosylation patterns affect cell behavior and disease pathology, thus providing insights into the biological significance of this critical enzyme in health and disease. As such, Mgat3 continues to be an important focus in glycoscience research, with the prospect of enhancing our understanding of cellular functions and disease mechanisms through detailed biochemical and biophysical studies.











