Analytical Data
-
Gene name
NUDT1
- Application
-
Alternative Names
NUDT1;MTH1;Oxidized purine nucleoside triphosphate hydrolase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P36639
-
Expression Region
19-197aa
-
AA Sequence
MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
-
Molecular Weight
22.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NUDT1, also known as Nudix hydrolase 1, is an enzyme that plays a crucial role in cellular nucleotide metabolism. It is part of the Nudix hydrolase family, which is known for its ability to hydrolyze various nucleoside diphosphates and nucleoside triphosphates, thereby regulating the levels of these important molecules within the cell. Research has shown that NUDT1 is involved in the detoxification of oxidized purine nucleotides, particularly 8-oxo-dGDP, which is a product of oxidative stress and can lead to DNA damage if not properly managed. Understanding the function of NUDT1 is essential, as it has implications in various biological processes, including DNA repair, cell signaling, and apoptosis. Novel insights into NUDT1's mechanism of action and regulation could provide significant therapeutic avenues for diseases associated with nucleotide imbalances and oxidative stress, such as cancer and neurodegenerative disorders. Due to its pivotal role in maintaining nucleotide homeostasis and protecting against oxidative damage, the study of NUDT1 and its recombinant protein has garnered attention in both basic and applied research, aiming to elucidate its structure-function relationship and potential as a target for drug discovery.
