Analytical Data
-
Gene name
MAFA
- Application
-
Alternative Names
2F1 Ag; 2F1; C type lectin domain family 15 member A; C-type lectin domain family 15 member A; CLEC15A; ITIM containing receptor MAFA L; ITIM-containing receptor MAFA-L; Killer cell lectin like receptor G1 ; Killer cell lectin like receptor subfamily G member 1; Killer cell lectin-like receptor subfamily G member 1; KLRG 1; KLRG1; KLRG1 protein; KLRG1_HUMAN; MAFA 2F1; MAFA; MAFA L; MAFA like; MAFA like receptor; MAFA-like receptor; MAFAL
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96E93
-
Expression Region
60-195aa
-
AA Sequence
LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF
-
Molecular Weight
31.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAFA, a key transcription factor in the pancreas, plays a vital role in the regulation of insulin gene expression and is crucial for maintaining glucose homeostasis. Research into the MAFA recombinant protein has gained significant attention due to its potential implications in diabetes treatment and beta-cell function enhancement. In the context of increasing global diabetes prevalence, understanding the molecular mechanisms by which MAFA influences insulin secretion and beta-cell maturation is essential. Studies have shown that MAFA can promote the differentiation of pancreatic progenitor cells into insulin-producing beta cells, making it a target for therapeutic strategies aimed at regenerating beta-cell mass in diabetic patients. Additionally, the recombinant production of MAFA allows for detailed functional assays and structural studies, which aid in elucidating its interaction with other transcriptional regulators and signaling pathways. The development of MAFA-based biomolecules could lead to novel approaches in cell therapy and the enhancement of islet transplantation outcomes, ultimately contributing to better management of diabetes. As research progresses, the modulation of MAFA expression and activity presents a promising frontier in diabetes research, highlighting the importance of this transcription factor in both basic science and clinical applications.
