Analytical Data
-
Gene name
PARK2
- Application
-
Alternative Names
PRKN;PARK2;E3 ubiquitin-Protein ligase parkin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60260
-
Expression Region
1-465aa
-
AA Sequence
MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV
-
Molecular Weight
55.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PARK2, also known as Parkin, is a gene that encodes an E3 ubiquitin ligase, playing a crucial role in protein degradation and cellular homeostasis. Mutations in the PARK2 gene are linked to autosomal recessive juvenile Parkinsonism, a neurodegenerative disease characterized by early-onset motor symptoms and subsequent degeneration of dopaminergic neurons. Research into PARK2 recombinant proteins has gained momentum due to their potential implications in understanding the molecular mechanisms underlying Parkinson's disease and related disorders. The recombinant Parkin protein is essential for elucidating its physiological functions, including its involvement in mitochondrial quality control and the clearance of aggregated proteins. Additionally, studying PARK2 in a recombinant form allows for the exploration of its interactions with other cellular components, providing insights into the pathways by which Parkin exerts its neuroprotective effects. Advances in recombinant DNA technology and protein expression systems have facilitated the production of functional PARK2 proteins, paving the way for structure-function analysis and high-throughput screening of small molecules that could modulate Parkin activity. This research not only contributes to a deeper understanding of Parkinson's pathogenesis but also holds promise for the development of novel therapeutic strategies aimed at restoring Parkin function or compensating for its loss in affected neurons.
