Analytical Data
-
Gene name
MASA
- Application
-
Alternative Names
Antigen identified by monoclonal R1 ; CAML1; CD171; CD171 antigen ; HSAS; HSAS1; Hyd; L1; L1 cell adhesion molecule; L1-NCAM; L1cam; L1CAM_HUMAN; MASA; MIC5; N CAML1 ; N-CAM-L1; NCAM-L1; NCAML1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P32004
-
Expression Region
1-115aa
-
AA Sequence
MKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST
-
Molecular Weight
38.39 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MASA (Meckel syndrome-related protein) is a crucial component in the study of various biological processes, particularly in the context of congenital disorders like Meckel syndrome, characterized by developmental anomalies. Research into MASA has gained momentum due to its role in cellular signaling pathways and its involvement in the maintenance of cellular architecture. The protein has shown to interact with cytoskeletal elements, influencing cellular morphology and motility, which are essential for normal organ development. Furthermore, mutations in the genes encoding MASA have been linked to specific phenotypic manifestations, encouraging investigations into its functionality and potential therapeutic targets. As the understanding of MASA’s structure and mechanisms deepens, it opens avenues for addressing genetic defects associated with its dysregulation. The ongoing studies aim to explore not only the fundamental biology of MASA but also its implications in disease pathology, potentially leading to novel approaches in diagnostics and treatment for congenital disorders. This highlights the importance of MASA in both basic research and clinical contexts, paving the way for advancements in regenerative medicine and genetic therapies.
