Analytical Data
-
Gene name
MGC34800
- Application
-
Alternative Names
Putative uncharacterized protein MGC34800
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N6K4
-
Expression Region
1-173 aa
-
AA Sequence
MGDLPWAPPEAQAPSTAGAGDVAEHQVAPARFLQGAWRQAAGWLCRETGAAPGSAQAGPPETAHAADPQPRGPQAPPRLPPSLSPERVHPGQPAAPAEPAPGAPALRSGPSQPRGLRLPVPVPACAGSSAPGSPAALPDSYPWPPPARNRPATLPPTSRVSPLAAFLASAPQR
-
Molecular Weight
43.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MGC34800 is a recombinant protein derived from the molecular cloning of the corresponding gene, which has garnered significant attention in the context of various biological and therapeutic applications. Initially identified through comprehensive genomic studies, MGC34800 is believed to play a crucial role in cellular processes, potentially influencing cell signaling, proliferation, or apoptosis. Its structure suggests a functional relationship with known pathways involved in disease mechanisms, particularly in cancer biology and immunology. The recombinant expression of MGC34800 allows for detailed studies of its biochemical properties and interactions with other biomolecules. Researchers have been focusing on characterizing this protein to elucidate its functional significance, including its potential as a biomarker or therapeutic target. The growing interest in MGC34800 ties into broader efforts in biotechnology and pharmaceuticals aimed at developing novel treatments or diagnostic tools, highlighting the importance of understanding its precise role in physiological and pathological contexts. Continued research into MGC34800 could pave the way for innovative strategies in disease management and provide insights into complex biological networks.
