Cat: PA2000-914DB

Recombinant Human CABP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CABP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CABP2;Calcium-binding Protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P56545

  • Expression Region

    1-445aa

  • AA Sequence

    MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPI LKDLATVAFCDAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRV IVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRRNT WLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAK AFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNH HLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHES EPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIP ESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLP AAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNEQ

  • Molecular Weight

    75 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CABP2 (Calcium Binding Protein 2) is a member of the calmodulin superfamily, which plays a pivotal role in calcium ion signaling within neurons. Its structure includes EF-hand motifs that enable it to bind calcium ions, thereby influencing various cellular processes such as synaptic transmission and neuronal excitability. Research on CABP2 has emerged due to its potential involvement in neurological disorders, including autism spectrum disorders and schizophrenia. Mutations in the CABP2 gene have been linked to altered calcium signaling pathways, which can disrupt normal neural functioning. Recent studies have focused on the recombinant expression of CABP2, enabling researchers to investigate its biochemical properties and functional roles in detail. By producing and purifying the recombinant CABP2 protein, scientists can perform various assays to elucidate its binding affinity for calcium and its interactions with other proteins involved in signaling pathways. Understanding CABP2's mechanistic role in calcium signaling may provide insights into its contribution to synaptic plasticity and neurological health, paving the way for potential therapeutic strategies targeting CABP2-related pathologies. These investigations underscore CABP2's significance in neuroscience and highlight the importance of protein studies in the context of gene mutations and their possible implications on brain function.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US