Analytical Data
-
Gene name
ROM1
- Application
-
Alternative Names
ROM1；TSPAN23；Rod outer segment membrane Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q03395
-
Expression Region
1-351aa
-
AA Sequence
MAPVLPLVLPLQPRIRLAQGLWLLSWLLALAGGVILLCSGHLLVQLRHLGTFLAPSCQFPVLPQAALAAGAVALGTGLVGVGASRASLNAALYPPWRGVLGPLLVAGTAGGGGLLVVGLGLALALPGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGTLGSMLAVTFLLQALVLLGLRYLQTALEGLGGVIDAGGETQGYLFPSGLKDMLKTAWLQGGVACRPAPEEAPPGEAPPKEDLSEA
-
Molecular Weight
37.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ROM1, or Retinal Outer Segment Membrane Protein 1, is a key protein located in the photoreceptor cells of the retina, specifically in the outer segments of rods and cones. It plays a crucial role in maintaining the structural integrity and function of these photoreceptors, which are essential for vision. Research into ROM1 has gained significance due to its association with various retinal diseases, including retinitis pigmentosa and age-related macular degeneration. Abnormalities in ROM1 expression or function can lead to photoreceptor degeneration, highlighting the need for a better understanding of its biochemical properties and the mechanisms underlying its role in retinal health. Recent advancements in molecular biology techniques have facilitated the study of ROM1, enabling scientists to investigate its interactions with other proteins and its impact on retinal cell physiology. Moreover, ROM1 has potential implications for gene therapy approaches aimed at treating inherited retinal dystrophies. As researchers continue to explore the functional dynamics of ROM1 and its role in retinal pathophysiology, it opens up new avenues for developing therapeutic strategies to combat visual impairment and preserve retinal function in affected individuals.
