Analytical Data
-
Gene name
IL-20R2
- Application
-
Alternative Names
IL-20R2；DIRS1；Interleukin-20 receptor subunit beta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UXL0
-
Expression Region
30-233aa
-
AA Sequence
DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPL
-
Molecular Weight
29.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IL-20R2, or Interleukin-20 Receptor subunit 2, is a member of the type II cytokine receptor family, playing a crucial role in immune responses and inflammatory processes. Its significance has been increasingly recognized in various diseases, including autoimmune disorders and skin conditions like psoriasis, where IL-20R2 mediates the effects of IL-20 and IL-24, cytokines implicated in inflammation and keratinocyte activities. Research has shown that IL-20R2 is primarily expressed in epithelial tissues, suggesting its involvement in the regulation of mucosal immunity and skin homeostasis. The development of recombinant IL-20R2 proteins has become essential for understanding its biological functions and potential therapeutic applications. These proteins facilitate the study of receptor-ligand interactions, signal transduction pathways, and the receptor's role in modulating immune responses. Furthermore, recombinant IL-20R2 can serve as a valuable tool in drug development, potentially leading to novel treatments for inflammatory and autoimmune diseases. As researchers continue to explore its mechanisms, the characterization of IL-20R2 remains a promising area of investigation that may yield significant insights into immune regulation and pave the way for innovative therapeutic strategies.
