Analytical Data
-
Gene name
SLC25A5
- Application
-
Alternative Names
SLC25A5; AAC2; ANT2; ADP/ATP translocase 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05141
-
Expression Region
2-298aa
-
AA Sequence
TDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRI PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWLYFAGNLASGG AAGATSLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSV QGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMMQ SGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYT
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC25A5, also known as the adenine nucleotide translocator (ANT), is a mitochondrial protein primarily involved in the exchange of ADP and ATP across the inner mitochondrial membrane, playing a crucial role in cellular energy metabolism. Dysregulation of SLC25A5 has been implicated in various metabolic disorders and diseases, including cancer, where altered energy production and nucleotide metabolism are common. Research on the recombinant protein SLC25A5 has gained significant attention as it provides insights into the protein's structure-function relationships, substrate specificity, and mechanisms of action. Scientists have utilized recombinant SLC25A5 to study its transport activity, elucidate its role in mitochondrial bioenergetics, and explore potential therapeutic interventions targeting mitochondrial dysfunction. Moreover, understanding how post-translational modifications affect SLC25A5 function is critical for developing strategies to manipulate ATP synthesis in diseased states. Overall, the investigation of SLC25A5 as a recombinant protein serves as a vital platform for advancing our comprehension of mitochondrial physiology and its implications in human health and disease.











