Cat: PA1000-2857

Recombinant Human SDCBP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SDCBP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SDCBP2;SITAC18;Syntenin-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H190

  • Expression Region

    1-292aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMSSLYPSLEDLKVDQAIQAQVRASPKM PALPVQATAISPPPVLYPNLAELENYMGLSLSSQEVQESLLQIPEGDSTA VSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVD QGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASG DKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLL TNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLP PVLLHHTMDHSIPDA

  • Molecular Weight

    34 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SDCBP2, or Syndecan-binding protein 2, plays a crucial role in various cellular processes, including cell adhesion, migration, and signaling, which are essential for normal tissue development and homeostasis. Researchers have identified SDCBP2 as a significant player in several pathological conditions, such as cancer metastasis and fibrosis. The study of SDCBP2 is particularly relevant due to its interactions with syndecans, a family of heparan sulfate proteoglycans that are involved in modulating cell-matrix interactions and signaling pathways. Given its potential as a therapeutic target, understanding the molecular mechanisms of SDCBP2 and its interactions with syndecans could provide insights into novel treatment strategies for diseases characterized by aberrant cell behavior. The production of recombinant SDCBP2 protein has enabled researchers to study its structural and functional properties in detail, facilitating the exploration of its role in cellular dynamics. Continued investigation into SDCBP2 could reveal its potential as a biomarker for disease progression and a target for therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US