Analytical Data
-
Gene name
GDE1
- Application
-
Alternative Names
GDE1；MIR16；Glycerophosphodiester phosphodiesterase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NZC3
-
Expression Region
1-331aa
-
AA Sequence
MWLWEDQGGLLGPFSFLLLVLLLVTRSPVNACLLTGSLFVLLRVFSFEPV PSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKNGATGVELDI EFTSDGIPVLMHDNTVDRTTDGTGRLCDLTFEQIRKLNPAANHRLRNDFP DEKIPTLREAVAECLNHNLTIFFDVKGHAHKATEALKKMYMEFPQLYNNS VVCSFLPEVIYKMRQTDRDVITALTHRPWSLSHTGDGKPRYDTFWKHFIF VMMDILLDWSMHNILWYLCGISAFLMQKDFVSPAYLKKWSAKGIQVVGWT VNTFDEKSYYESHLGSSYITDSMVEDCEPHF
-
Molecular Weight
37.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GDE1, or Glycerophosphodiester phosphodiesterase 1, is an enzyme involved in the hydrolysis of glycerophosphodiester substrates, playing a crucial role in phospholipid metabolism and signaling pathways. Its significance extends to various biological processes, including neuronal function, cell signaling, and the regulation of phosphoinositide levels. Recent studies have highlighted that dysregulation of GDE1 can be implicated in several diseases, particularly in the context of neurodegenerative disorders, where altered lipid signaling can exacerbate pathological conditions. The necessity for recombinant GDE1 protein production arises from its potential as a therapeutic target and its utility in understanding the molecular mechanisms underlying its function. The research surrounding GDE1 involves the characterization of its enzymatic activity, substrate specificity, and interaction with other cellular components, providing insights into its role in disease mechanisms. Furthermore, the development of recombinant GDE1 facilitates structure-function studies, aiding in the design of specific inhibitors or modulators that could serve as viable therapeutic agents. Overall, GDE1 represents a significant focus in the field of molecular biology and biochemistry, intertwining basic research with the prospect of clinical applications aimed at treating related disorders.
