Analytical Data
-
Gene name
SLAMF6
- Application
-
Alternative Names
SLAMF6;KALI;SLAM family member 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96DU3
-
Expression Region
28-225aa
-
AA Sequence
QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETK SPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSS YTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGN TLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQY TDTKVDHHHHHH
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLAMF6 (Signaling Lymphocytic Activation Molecule Family member 6) is a member of the SLAM family of receptors, which are primarily expressed on immune cells and play critical roles in regulating immune responses. Research into SLAMF6 has gained momentum due to its involvement in various immune processes, including T cell activation, proliferation, and survival. It is particularly significant in the context of autoimmune diseases and cancers, where dysregulation of immune signaling pathways can lead to pathologies. The interest in SLAMF6 is further driven by its potential as a therapeutic target and biomarker for immune-related conditions. The recombinant expression of SLAMF6 protein allows for detailed studies of its structure, function, and interactions with other molecules. This research can enhance our understanding of immune modulation and facilitate the development of novel immunotherapies. As scientists continue to explore the mechanistic pathways involving SLAMF6, the characterization of its recombinant protein becomes crucial for elucidating its role in immune system dynamics and for designing interventions that can effectively manipulate these pathways for therapeutic benefits.
