Analytical Data
-
Gene name
SLA2
- Application
-
Alternative Names
SLA2;C20orf156;SLAP2;Src-like-adapter 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H6Q3
-
Expression Region
1-261aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMGSLPSRRKSLPSPSLSSSVQGQGPVT MEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWWTVLSEVSG REYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRR GSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYS ELADDICCLLKEPCVLQRAGPLPGKDIPLPVTVQRTPLNWKELDSSLLFS EAATGEESLLSEGLRESLSFYISLNDEAVSLDDA
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLA2 (SLA2 protein) is a protein encoded by the SLA2 gene, which plays a crucial role in various cellular processes, particularly in yeast and other eukaryotic organisms. Research into SLA2 has gained traction due to its involvement in endocytosis and the maintenance of cell integrity, which are vital for cellular homeostasis and function. As a component of the Endocytic Pathway, SLA2 is believed to interact with several other proteins, participating in the recruitment of clathrin and other essential factors necessary for vesicle formation. Understanding the structure and function of SLA2 not only provides insights into fundamental cellular mechanisms but also has implications in broader biological contexts such as signal transduction, cellular response to stress, and cell division. Enhanced knowledge of SLA2 and its associated pathways can potentially lead to biomedical advancements, particularly in the realm of therapeutic targets for diseases related to cellular dysregulation. Given its multifaceted roles, the study of the SLA2 recombinant protein has significant implications for unraveling the complexities of cell biology and developing innovative treatments for diseases.
