Analytical Data
-
Gene name
ACATE2
- Application
-
Alternative Names
MTE1、PTE2、CTE1A、PTE2A、CTE - IA、ZAP128
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96EA2
-
Expression Region
1-212aa
-
AA Sequence
MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKG
-
Molecular Weight
49.06 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ACATE2, a member of the acyl-CoA thioesterase family, plays a crucial role in lipid metabolism and cellular signaling pathways. Its unique enzymatic activity is involved in the hydrolysis of acyl-CoA thioesters, thereby regulating the availability of free fatty acids and impacting cellular energy homeostasis. Recent studies have indicated that ACATE2 may also participate in various physiological processes, including inflammation and metabolic disorders. Given the rising prevalence of obesity and related diseases, understanding the functional mechanisms of ACATE2 has garnered significant interest. Researchers are exploring its potential as a therapeutic target for metabolic conditions such as diabetes and cardiovascular diseases. The recombinant expression and purification of ACATE2 provide essential tools for detailed biochemical characterization, structural analysis, and the development of inhibitors or activators that could modulate its activity. This research area is promising, as elucidating ACATE2's role in metabolic pathways could unveil novel strategies for intervention in metabolic syndromes. Overall, ACATE2 stands out as a significant focus in the field of metabolic research, reflecting the ongoing efforts to address the challenges posed by metabolic diseases.











