Analytical Data
-
Gene name
SKP
- Application
-
Alternative Names
SKP1;EMC19;OCP2;SKP1A;S-phase kinase-associated Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0AEU7
-
Expression Region
21-161aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMADKIAIVNMGSLFQQVAQKTGVSNTLENE FKGRASELQRMETDLQAKMKKLQSMKAGSDRTKLEKDVMAQRQTFAQKAQ AFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDANAVAYNSSDV KDITADVLKQVK
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of SKP recombinant proteins is rooted in the need to better understand the functions and mechanisms of the SKP (S-phase Kinase-associated protein) family of proteins, which play critical roles in various cellular processes, including cell cycle regulation, protein degradation, and signal transduction. SKP proteins are integral components of the SCF (SKP1-Cullin-F-box) ubiquitin ligase complex, which is essential for the ubiquitin-proteasome pathway, a major pathway that regulates protein turnover and cellular homeostasis. Research has indicated that dysregulation of SKP proteins is linked to various diseases, including cancer, as their aberrant activity can lead to uncontrolled cell proliferation and tumorigenesis. The recombinant production of SKP proteins allows for in-depth studies of their structure, function, and interactions within the cell. By using techniques such as genetic engineering and protein purification, scientists can create large quantities of these proteins for functional assays, structural characterization, and potential therapeutic applications. Understanding the precise role of SKP proteins in cellular pathways not only enhances our fundamental knowledge of cellular biology but also paves the way for the development of targeted therapeutics aimed at diseases associated with SKP dysregulation. Thus, the research surrounding SKP recombinant proteins is pivotal in bridging the gap between basic research and clinical advancements, with the ultimate goal of improving therapeutic strategies against related pathologies.
