Analytical Data
-
Gene name
OR10H2
- Application
-
Alternative Names
OR10H2; Olfactory receptor 10H2; Olfactory receptor OR19-23
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60403
-
Expression Region
1-315 aa
-
AA Sequence
MLGLNHTSMSEFILVGFSAFPHLQLMLFLLFLLMYLFTLLGNLLIMATVWSERSLHTPMY LFLCVLSVSEILYTVAIIPRMLADLLSTQRSIAFLACASQMFFSFSFGFTHSFLLTVMGY DRYVAICHPLRYNVLMSPRGCACLVGCSWAGGSVMGMVVTSAIFQLTFCGSHEIQHFLCH VPPLLKLACGNNVPAVALGVGLVCIMALLGCFLLILLSYAFIVADILKIPSAEGRNKAFS TCASHLIVVIVHYGFASVIYLKPKGPHSQEGDTLMATTYAVLTPFLSPIIFSLRNKELKV AMKRTFLSTLYSSGT
-
Molecular Weight
34.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR10H2 protein, a member of the olfactory receptor (OR) family, has gained attention in recent research due to its potential roles in sensory perception and its implications in various physiological processes. Olfactory receptors, including OR10H2, are G-protein-coupled receptors (GPCRs) primarily involved in the detection of odorants, contributing to the sense of smell. Recent studies have suggested that ORs may also be implicated in non-olfactory functions, such as neurogenesis, immune response, and even certain types of cancer. The unique expression patterns of OR10H2 in specific tissues, including the brain and non-neuronal cells, suggest that it could be involved in pathways beyond olfaction. Moreover, understanding the structure-function relationship of OR10H2 through recombinant protein studies may elucidate its functional mechanisms, opening up avenues for therapeutic applications. The reconstitution of OR10H2 in heterologous systems allows researchers to investigate its ligand binding and signaling properties in a controlled environment, thereby providing insights into the molecular basis of its interactions and biological significance. With the emergence of advanced techniques in protein expression and purification, the study of OR10H2 is poised to enhance our comprehension of olfactory signal transduction and its broader implications in health and disease.
