Analytical Data
-
Gene name
OR10K1
- Application
-
Alternative Names
OR10K1; Olfactory receptor 10K1; Olfactory receptor OR1-6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGX5
-
Expression Region
1-313 aa
-
AA Sequence
MEQVNKTVVREFVVLGFSSLARLQQLLFVIFLLLYLFTLGTNAIIISTIVLDRALHTPMY FFLAILSCSEICYTFVIVPKMLVDLLSQKKTISFLGCAIQMFSFLFFGSSHSFLLAAMGY DRYMAICNPLRYSVLMGHGVCMGLMAAACACGFTVSLVTTSLVFHLPFHSSNQLHHFFCD ISPVLKLASQHSGFSQLVIFMLGVFALVIPLLLILVSYIRIISAILKIPSSVGRYKTFST CASHLIVVTVHYSCASFIYLRPKTNYTSSQDTLISVSYTILTPLFNPMIYSLRNKEFKSA LRRTIGQTFYPLS
-
Molecular Weight
35.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR10K1 is a member of the olfactory receptor gene family, which plays a significant role in the sensory perception of smell. Its expression has drawn attention due to its potential involvement in neurobiological processes and its implications in various physiological and pathological conditions. Recent studies have indicated that OR10K1 may also be implicated in non-olfactory functions, as its expression has been detected in several tissues beyond the olfactory system, including the central nervous system. The interest in OR10K1 has been further heightened by emerging evidence suggesting its association with neurological diseases, showing that alterations in the function or expression of this receptor may contribute to cognitive and sensory disorders. Recombining OR10K1 into functional proteins allows researchers to explore its binding properties, activate downstream signaling pathways, and understand its overall biological roles. With this recombinant protein, scientists aim to elucidate the receptor's structure-function relationships, its ligand interactions, and its potential as a therapeutic target for conditions associated with sensory dysfunction. The ongoing investigation into OR10K1 not only enhances our understanding of olfactory receptor functionality but could also pave the way for innovative approaches in neurology and sensory biology, for developing diagnostic and therapeutic strategies in sensory-related disorders.
