Analytical Data
-
Gene name
APEG1
- Application
-
Alternative Names
REF1、Redox Factor-1、HAP1、DNA-(Apurinic or Apyrimidinic Site) Lyase
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15772
-
Expression Region
1-113aa
-
AA Sequence
MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE
-
Molecular Weight
38.17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
APEG1, or Apoptosis-Related Protein 1, is a protein that has garnered significant attention in the field of molecular biology due to its potential role in apoptosis, cell proliferation, and cancer progression. Research indicates that APEG1 is involved in regulating cellular responses to stress and can influence the fate of cells under various physiological conditions. Its expression levels have been found to correlate with tumorigenesis, making it a potential biomarker for cancer diagnosis and prognosis. Studies have also suggested that APEG1 may interact with various signaling pathways, such as those related to survival and cell death, further complicating its functional profile. Given its importance in cancer biology, there is a growing interest in the mechanistic insights underlying APEG1's role in cellular processes. Additionally, understanding the structural and functional characteristics of APEG1 could provide valuable information for therapeutic interventions aimed at modulating its activity. The ongoing research into APEG1 aims to clarify its biological functions and explore its potential as a target for novel cancer treatments, thereby contributing to the development of more effective strategies in oncology.
