Analytical Data
-
Gene name
MTCH2
- Application
-
Alternative Names
MTCH2；MIMP；Mitochondrial carrier homolog 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y6C9
-
Expression Region
1-303aa
-
AA Sequence
MADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFAGLVPRLLGDILSLWLCNSLAYLVNTYALDSGVSTMNEMKSYSQAVTGFFASMLTYPFVLVSNLMAVNNCGLAGGCPPYSPIYTSWIDCWCMLQKEGNMSRGNSLFFRKVPFGKTYCCDLKMLI
-
Molecular Weight
33.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MTCH2 (Mitochondrial Carrier Homolog 2) is a protein that plays a crucial role in mitochondrial function and cellular metabolism. It is part of the mitochondrial carrier family, which is responsible for the transport of various metabolites across the mitochondrial membrane. Research has indicated that MTCH2 is involved in regulating apoptosis, energy metabolism, and the stabilization of mitochondrial membranes. Dysregulation of MTCH2 expression has been implicated in various diseases, including cancer and metabolic disorders, making it a significant focus of biomedical research. Studies have demonstrated that MTCH2 interacts with several binding partners, influencing cellular signaling pathways and mitochondrial dynamics. The generation of recombinant MTCH2 protein enables researchers to investigate its structure, function, and interaction with other proteins in detail. This is essential for understanding its role in mitochondrial biology and its potential as a therapeutic target. By studying MTCH2, scientists aim to uncover the underlying mechanisms of mitochondrial dysfunction and its broader implications in health and disease.
