Analytical Data
-
Gene name
TREM2
- Application
-
Alternative Names
TREM2；Triggering receptor expressed on myeloid cells 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NZC2
-
Expression Region
19-174aa
-
AA Sequence
HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHN LWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEA DTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEI PFPPTS
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TREM2 (Triggering Receptor Expressed on Myeloid Cells 2) is an immune receptor predominantly expressed on microglia, the resident immune cells of the central nervous system. Recent research has highlighted its critical role in neuroinflammation and neurodegenerative diseases, particularly Alzheimer's disease. Mutations in the TREM2 gene have been linked to an increased risk of developing late-onset Alzheimer's, suggesting that TREM2 signaling pathways are essential for maintaining brain homeostasis and modulating inflammatory responses. Given its significance, the production of recombinant TREM2 protein has gained prominence in scientific research, allowing for detailed studies on its structure, function, and interactions with various ligands. Understanding the mechanisms by which TREM2 operates can provide insights into its protective roles in the brain and promote the exploration of TREM2 as a potential therapeutic target. Thus, the study of recombinant TREM2 protein not only elucidates its biological functions but also aims to advance our knowledge of its implications in neurodegenerative diseases, paving the way for novel treatment strategies.
