Analytical Data
-
Gene name
ACSL1
- Application
-
Alternative Names
ACSL1；FACL1；FACL2；LACS；Long-chain-fatty-acid--CoA ligase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P33121
-
Expression Region
48-145aa
-
AA Sequence
PKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQ RGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ACSL1, or acyl-CoA synthetase long-chain family member 1, plays a critical role in fatty acid metabolism and is involved in the activation of long-chain fatty acids to form acyl-CoA derivatives. Its significance extends beyond metabolism, as it has been implicated in various physiological processes, including membrane lipid synthesis, energy homeostasis, and signaling pathways. Dysregulation of ACSL1 has been associated with metabolic disorders, cancer, and cardiovascular diseases, making it a target of considerable interest in biomedical research. The recombinant expression of ACSL1 allows for the detailed study of its enzymatic activity and regulatory mechanisms, facilitating the understanding of its role in lipid metabolism and its contributions to disease pathogenesis. By producing recombinant ACSL1, researchers can investigate the protein's structure-function relationships, determine its specific substrate preferences, and explore its interactions with other metabolic pathways. This knowledge is vital for developing therapeutic strategies aimed at modulating ACSL1 activity in disease contexts, thereby providing insights into potential interventions for metabolic syndrome, obesity, and related disorders. Additionally, studies on ACSL1 can contribute to the broader understanding of lipid homeostasis and its implications in health and disease.
