Cat: PA2000-1652

Recombinant Human GCGR Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GCGR

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GCGR;Glucagon receptor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P47871

  • Expression Region

    26-136aa

  • AA Sequence

    AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANT TANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDG EEIEVQKEVAK

  • Molecular Weight

    54 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Glucagon receptor (GCGR) is a key player in glucose metabolism and is primarily involved in regulating glucose levels in the blood. Its role in the pathophysiology of diabetes and related metabolic disorders has sparked significant scientific interest. GCGR is a member of the class B G-protein coupled receptor family, and its activation by glucagon leads to an increase in hepatic glucose production, which is critical for maintaining energy homeostasis. Therefore, understanding the structure and function of GCGR is essential for developing therapeutic strategies targeting diabetes and hypoglycemia. Recent advancements in recombinant protein technology have facilitated the production of GCGR in heterologous systems, enabling detailed studies of its biochemical properties, ligand-binding dynamics, and signaling pathways. This research is crucial for elucidating GCGR's role in glucose regulation and for the discovery of novel medications that can modulate its activity to improve glycemic control in diabetic patients. Furthermore, characterized GCGR recombinant proteins serve as vital tools in drug development, aiding in the design of analogs and antagonists that could potentially lead to innovative treatments for metabolic diseases. Overall, the exploration of GCGR’s structural biology and signaling mechanisms continues to be a prominent focus within metabolic research, promising to yield significant insights into new therapeutic avenues.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US