Analytical Data
-
Gene name
PHIP
- Application
-
Alternative Names
PHIP; DCAF14; WDR11; PH-interacting protein; PHIP; DDB1- and CUL4-associated factor 14; IRS-1 PH domain-binding protein; WD repeat-containing protein 11
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WWQ0
-
Expression Region
1599-1705 aa
-
AA Sequence
TLSKSSAVIEQGDCKNNALVPGTIQVNGHGGQPSKLVKRGPGRKPKVEVNTNSGEIIHKKRGRKPKKLQYAKPEDLEQNNVHPIRDEVLPSSTCNFLSETNNVKEDL
-
Molecular Weight
37.51 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PHIP (PH domain and leucine-rich repeat protein) is an essential protein implicated in various cellular processes, including signal transduction, cellular growth, and differentiation. Research has increasingly focused on PHIP due to its association with critical physiological and pathological conditions, such as cancer and metabolic disorders. The protein is known to interact with multiple signaling pathways, particularly those related to insulin signaling and glucose metabolism, making it a potential target for therapeutic intervention. Advances in recombinant DNA technology have enabled the production of PHIP in a controlled laboratory setting. This recombinant PHIP allows for detailed structural and functional studies, helping to unravel its biological roles and mechanisms of action. By understanding how PHIP participates in cellular signaling cascades, researchers aim to elucidate its contributions to disease processes. Moreover, dissecting the structure-function relationship of PHIP can lead to the identification of novel biomarkers or drug targets, ultimately contributing to the development of innovative strategies for disease management. As such, the study of recombinant PHIP represents a significant avenue in biomedical research, linking basic science to potential clinical applications.
