Analytical Data
-
Gene name
YIF1B
- Application
-
Alternative Names
YIF1B；Protein YIF1B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5BJH7
-
Expression Region
1-156aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMHPAGLAAAAAGTPRLRKWPSKRRIPV SQPGMADPHQLFDDTSSAQSRGYGAQRAPGGLSYPAASPTPHAAFLADPV SNMAMAYGSSLAAQGKELVDKNIDRFIPITKLKYYFAVDTMYVGRKLGLL FFPYLHQDWEVQYQQDTPVAPRFDVNAPD
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
YIF1B (Yip1 Domain Family Member 1B) is a protein that plays a crucial role in the biogenesis of lysosomes and the regulation of intracellular trafficking. It is a member of the Yip1 family, known for their involvement in membrane dynamics and organelle fusion processes. Given the importance of lysosomal function in cellular homeostasis and the pathogenic implications of lysosomal dysfunction in various diseases, including neurodegenerative disorders and cancer, YIF1B has garnered significant research interest. Studies have indicated that YIF1B is involved in the endocytic pathway, influencing the sorting and delivery of proteins to lysosomes. Understanding the molecular mechanisms underlying YIF1B function and its interactions with other cellular components is essential for elucidating its role in health and disease. The recombinant expression of YIF1B allows for detailed biochemical characterization and structural studies, enabling researchers to explore its functional properties and potential as a therapeutic target. By studying YIF1B, scientists aim to shed light on its contribution to cellular processes and its implications in pathophysiological conditions, paving the way for novel strategies in disease intervention.
