Analytical Data
-
Gene name
PIGP
- Application
-
Alternative Names
PIGP; DCRC; DSCR5; DSCRC; NPD010; Phosphatidylinositol N-acetylglucosaminyltransferase subunit P; Down syndrome critical region protein 5; Down syndrome critical region protein C; Phosphatidylinositol-glycan biosynthesis class P protein; PIG-P
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P57054
-
Expression Region
1-134 aa
-
AA Sequence
MVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFIPESWLNSLGLTYWPQKYWAVALPVYLLIAIVIGYVLLFGINMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN
-
Molecular Weight
40.37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PIGP, or Phosphatidylinositol Glycan Anchor Biosynthesis Class P, is a key protein involved in the biosynthesis of glycosylphosphatidylinositol (GPI) anchors, which are important for the attachment of proteins to cell membranes. GPI-anchored proteins play crucial roles in various biological processes, including cell signaling, adhesion, and protein localization. Mutations or dysfunctions in the genes responsible for GPI anchor biosynthesis can lead to a range of human diseases, including neurodegenerative disorders and developmental syndromes. Research on recombinant PIGP is essential to elucidate its function and the mechanisms underlying GPI anchor biosynthesis. By producing PIGP as a recombinant protein, scientists aim to investigate its enzymatic activity, identify potential interactions with other proteins, and explore its regulatory role in GPI anchor formation. This research not only enhances our understanding of fundamental biological processes but also holds potential implications for therapeutic strategies targeting diseases related to GPI anchor deficiencies. Additionally, the study of PIGP and its pathway may contribute to advancements in biotechnology, including the development of novel drug delivery systems that utilize GPI anchors for enhanced stability and efficacy.
