Analytical Data
-
Gene name
IL10RB
- Application
-
Alternative Names
IL10RB；CRFB4；Interleukin-10 receptor subunit beta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q08334
-
Expression Region
20-220aa
-
AA Sequence
MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNT TLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQ VEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQI TPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVP SVDHHHHHH
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-10 receptor beta (IL10RB) is a crucial component of the interleukin-10 (IL-10) signaling pathway, which plays a significant role in regulating immune responses and maintaining homeostasis. Research has shown that IL-10, through its receptor complex involving IL10RB, exerts anti-inflammatory effects, making it an important target for therapeutic interventions in autoimmune diseases and chronic inflammatory conditions. Studies have indicated that variations or mutations in the IL10RB gene can be associated with susceptibility to various diseases, including systemic lupus erythematosus and inflammatory bowel disease. The recombinant protein of IL10RB allows researchers to explore its function, interactions with other signaling molecules, and its role in immune modulation in a controlled environment. By generating IL10RB as a recombinant protein, scientists can investigate its potential for therapeutic applications, including the development of targeted biologics that could restore IL-10 signaling in conditions where it is disrupted. Furthermore, understanding the structural and functional properties of IL10RB can provide insights into its role in receptor heterodimer formation and downstream signaling pathways, thereby contributing to the wider understanding of cytokine signaling and its implications in disease pathology. Overall, IL10RB recombinant protein research holds promise for advancing therapeutic strategies against immune-mediated diseases and enhancing our understanding of immune regulation mechanisms.
