Analytical Data
-
Gene name
PSMD14
- Application
-
Alternative Names
PSMD14;POH1;26S proteasome non-ATPase regulatory subunit 14
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00487
-
Expression Region
1-310aa
-
AA Sequence
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
-
Molecular Weight
79.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSMD14, a crucial component of the 26S proteasome, is involved in the regulation of protein degradation and cellular homeostasis. It plays a vital role in various cellular processes, including the modulation of signaling pathways, the response to oxidative stress, and the regulation of cell cycle progression. Recent studies have highlighted its significance in cancer progression, neurodegenerative diseases, and immune responses, making it a compelling target for therapeutic interventions. The understanding of PSMD14 function at the molecular level has been enhanced through the development of recombinant protein technologies, allowing researchers to produce active forms of the protein for detailed biochemical analysis. These studies aim to elucidate the mechanistic roles of PSMD14 in disease contexts and its potential as a biomarker or therapeutic target. Moreover, the exploration of its interactions with other proteasomal components and regulatory factors is crucial for developing strategies to modulate its activity in various clinical scenarios. The challenges in studying PSMD14, such as its stability and functionality in vitro, have led to innovative approaches in recombinant protein expression and purification methodologies. Overall, the research on PSMD14 recombinant proteins is paving the way for a deeper understanding of proteostasis and its implications in health and disease.











