Cat: PA2000-1711

Recombinant Human PSMD14 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PSMD14

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PSMD14;POH1;26S proteasome non-ATPase regulatory subunit 14

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00487

  • Expression Region

    1-310aa

  • AA Sequence

    MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK

  • Molecular Weight

    79.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PSMD14, a crucial component of the 26S proteasome, is involved in the regulation of protein degradation and cellular homeostasis. It plays a vital role in various cellular processes, including the modulation of signaling pathways, the response to oxidative stress, and the regulation of cell cycle progression. Recent studies have highlighted its significance in cancer progression, neurodegenerative diseases, and immune responses, making it a compelling target for therapeutic interventions. The understanding of PSMD14 function at the molecular level has been enhanced through the development of recombinant protein technologies, allowing researchers to produce active forms of the protein for detailed biochemical analysis. These studies aim to elucidate the mechanistic roles of PSMD14 in disease contexts and its potential as a biomarker or therapeutic target. Moreover, the exploration of its interactions with other proteasomal components and regulatory factors is crucial for developing strategies to modulate its activity in various clinical scenarios. The challenges in studying PSMD14, such as its stability and functionality in vitro, have led to innovative approaches in recombinant protein expression and purification methodologies. Overall, the research on PSMD14 recombinant proteins is paving the way for a deeper understanding of proteostasis and its implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US