Cat: PA1000-3817

Recombinant Human Rtn4r Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Rtn4r

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Rtn4r;NOGOR;Reticulon-4 receptor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BZR6

  • Expression Region

    27-447aa

  • AA Sequence

    CPGACVCYNEPKVTTSCPQQGLQAVPVGIPAASQRIFLHGNRISHVPAAS FRACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLSDNAQLRSVDPATF HGLGRLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNALQALPDDTFRD LGNLTHLFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAHVHPHAFRDLG RLMTLYLFANNLSALPTEALAPLRALQYLRLNDNPWVCDCRARPLWAWLQ KFRGSSSEVPCSLPQRLAGRDLKRLAANDLQGCAVATGPYHPIWTGRATD EEPLGLPKCCQPDAADKASVLEPGRPASAGNALKGRVPPGDSPPGNGSGP RHINDSPFGTLPGSAEPPLTAVRPEGSEPPGFPTSGPRRRPGCSRKNRTR SHCRLGQAGSGGGGTGDSEGSVDHHHHHH

  • Molecular Weight

    46 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Rtn4r, or Reticulon 4 receptor, is a member of the reticulon family of proteins known for their critical roles in maintaining endoplasmic reticulum (ER) morphology and cellular stress response. It is predominantly expressed in the nervous system and has garnered significant interest due to its involvement in neurodevelopment and neurodegenerative diseases. Research has shown that Rtn4r can modulate the stability of neuronal membranes and influence synaptic function, which is vital for neuronal communication. Moreover, its association with various pathological conditions, including Alzheimer’s and multiple sclerosis, highlights the need for a deeper understanding of its structure and function. The study of Rtn4r recombinant proteins offers valuable insights into its biological roles, providing a platform for potential therapeutic interventions. By investigating the interactions of Rtn4r with other cellular proteins and its impact on ER dynamics, researchers aim to uncover novel strategies for mitigating neurodegenerative processes and promoting neuronal survival in detrimental environments. Thus, Rtn4r serves as a focal point for exploring the complex interplay between cellular homeostasis and neuroprotection, paving the way for advancements in neurobiology and drug development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US