Cat: PA2000-1732

Recombinant Human gox Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    gox

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    gox;GOX1;2-Hydroxyacid oxidase 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UJM8

  • Expression Region

    1-370aa

  • AA Sequence

    MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMLPRLICINDYEQH AKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLST SVLGQRVSMPICVGATAMQRMAHVDGELATVRACQSLGTGMMLSSWATSS IEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYL GNRLDDVRNRFKLPPQLRMKNFETSTLSFSPEENFGDDSGLAAYVAKAID PSISWEDIKWLRRLTSLPIVAKGILRGDDAREAVKHGLNGILVSNHGARQ LDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDVLKALALGAKAVFVG RPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQNVKVIDKTLVRKNP LAVSKI

  • Molecular Weight

    45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Research on the GOx (glucose oxidase) recombinant protein has gained significant attention due to its diverse applications in biotechnology and medicine. GOx, an enzyme that catalyzes the oxidation of glucose to gluconic acid and hydrogen peroxide, serves as an essential tool in various fields, including biosensors, food preservation, and biocatalysis. The rise of synthetic biology has enabled the production of GOx through recombinant DNA technology, allowing for higher yields, enhanced purity, and tailored properties compared to enzyme extracted from natural sources. Further, recombinant GOx can be engineered to exhibit improved stability and activity in specific conditions, broadening its applicability. Its role in glucose monitoring has been particularly important for diabetes management, leading to the development of advanced glucose biosensors that offer rapid and accurate readings while minimizing interference. Moreover, GOx has shown potential in cancer therapy, as hydrogen peroxide produced during its enzymatic activity can induce cytotoxic effects in tumor cells. The ongoing research focuses on optimizing the expression systems, purification methods, and functional modifications of recombinant GOx to fully harness its potential, ensuring a sustainable and efficient supply for industrial and medical applications. Overall, the study of recombinant GOx is a promising avenue for advancing technologies in health care, environmental management, and food industry enhancements.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US