Analytical Data
-
Gene name
CD55
- Application
-
Alternative Names
CD55；CR；Complement decay-accelerating factor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P08174
-
Expression Region
35-126aa
-
AA Sequence
DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVE
-
Molecular Weight
45.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD55, also known as decay-accelerating factor (DAF), is a membrane protein that plays a critical role in the regulation of the complement system, an essential component of the immune response. It protects host cells from complement-mediated lysis by inhibiting the formation of the C3 convertase, thereby preventing excessive inflammation and tissue damage. The study of recombinant CD55 protein has gained significant attention due to its potential therapeutic applications, particularly in the treatment of complement-mediated diseases, such as atypical hemolytic uremic syndrome and paroxysmal nocturnal hemoglobinuria. Furthermore, as a promising candidate for cancer immunotherapy, CD55 may help in enhancing the efficacy of monoclonal antibodies by improving the protective mechanisms of tumor cells against complement attack. Advances in recombinant DNA technology have facilitated the production of CD55 in various expression systems, allowing for detailed structural and functional studies. Understanding the precise interactions between CD55 and complement components can provide insights into the design of novel therapeutic strategies aimed at modulating immune responses. Overall, the research surrounding recombinant CD55 protein is pivotal for developing innovative treatments for complement-related disorders and improving the effectiveness of cancer therapies.
